PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_E01675F4E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Nin-like
Protein Properties Length: 862aa    MW: 94703.7 Da    PI: 6.3571
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_E01675F4E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.7e-29512563152
                 RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                            aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Traes_3AS_E01675F4E.1 512 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 563
                            589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.643502583IPR003035RWP-RK domain
PfamPF020423.0E-26515563IPR003035RWP-RK domain
SuperFamilySSF542773.24E-22759853No hitNo description
PROSITE profilePS5174519.817768850IPR000270PB1 domain
PfamPF005643.8E-15768849IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.6E-26768849No hitNo description
SMARTSM006661.8E-24768850IPR000270PB1 domain
CDDcd064071.00E-33769849No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
PAAAPDNTAA VPEETQRARS GNSDTPIKKT ERLNNKWQFN LALHDDSTNS SCLFKEKLTH  60
ALRYFKESTD QHLLVQVWAP VKSGDRYVLT TSGQPFVLDH QSIGLLQYRA VSMMYMFSVD  120
GDNAGELGLP GRVYKQKVPE WTPNVQYYSS TEYPRLNHAI SYNVHGTVAL PVFDPSVQSC  180
IAVVELIMTS KKINYADEVD KVCKALEAVN LKSTEILEHP NVQICNEGRQ SALVEILEIL  240
TVVCEEHKLP LAQTWVPCKY RSVLAHGGGV KKSCLSFDGS CMGEVCMSTS DVAFHVIDAH  300
MWGFRDACVE HHLQKGQGVS GKAFIYHRPC FSKDISQFCK LEYPLVHYAR MFGLAGCFAI  360
CLQSPYTGDD YYMLEFFLPP SCKEEDDQNA LLESILGLIN QCLRNLKVAG NGESNEASLQ  420
LSNVIMIESE DFKTNVHFEN SEGFRESPEG DTHGGAHEFD KANSKVSEGH LLADDNSQNN  480
GVSVSRPNGS AASDSSLLHK NGKPPERRRG KAEKTISLEV LQQYFSGSLK NAAKSLGVCP  540
TTMKRICRQH GISRWPSRKI NKVNRSLSKL KQVIESVQGS DAAFNLTSIT GPLPTIPVGP  600
SSDSFNKEKA SESKAEHSNR AVDGDRDSSL QKPQENGSHF GALMSQQGFA DTGNNVQLEA  660
DKASLSRSSS GEGSINSRTS EGSCQGSPAN QTFVCQPIAS MFLEPQEPQL NPEGFTKEPF  720
QEPELPLSRM LIEDSGSSKD LKNLFGSAIG QPMLAPPSNF GPMRNSGTVT IKASFKEDIV  780
RFRFPCSSSV MALKDEVAKR LRMDAGMFDI KYLDDDHEWV KLACNADLEE CIEISRHSGT  840
HVIRLLVTDV AAHIGSSCGS SG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLW5CNF00.0W5CNF0_WHEAT; Uncharacterized protein
STRINGBRADI2G08177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]